PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G26840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 307aa    MW: 33068.8 Da    PI: 7.1559
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G26840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601352.8e-4271061100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++e+reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++ ++
  ORUFI03G26840.1   7 PCAACKLLRRKCTQGCVFAPYFPPDQPAKFANVHKVFGASNVTKLLNDLQPEQREDAVNSLAYEAEARLRDPVYGCVAYISILQLRIKQVRDQI 100
                      7********************************************************************************************9 PP

           DUF260  95 allkee 100
                      + +++e
  ORUFI03G26840.1 101 VDARKE 106
                      998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381551.9E-1174307IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.7386107IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-427103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DQPAKFANVH KVFGASNVTK LLNDLQPEQR  60
EDAVNSLAYE AEARLRDPVY GCVAYISILQ LRIKQVRDQI VDARKELAAY IGPTAFAPVV  120
AAAAPHTHYL PPADYHHQQL QAQGGGGGAG MGAAGYAHQV VQHQMAGLQV QNPHPHPHPH  180
HHHHHQQMVN AQHMALVEVA RDQDMLRARQ AGHANAGATV AVEAPGSSSL NADTFDGGPF  240
LLRQQPPSSV QTEPAMALPY HMEPSPPQPS SGHSHDEVSQ QQQHHHHHRH HHTDGSDEGS  300
GGAAPPG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1369720.0AC136972.3 Oryza sativa chromosome 3 BAC OSJNBb0007E22 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629364.10.0PREDICTED: LOB domain-containing protein 36
TrEMBLA0A0E0NY750.0A0A0E0NY75_ORYRU; Uncharacterized protein
STRINGLOC_Os03g41600.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-60ASYMMETRIC LEAVES 2-like 1